The domain within your query sequence starts at position 167 and ends at position 229; the E-value for the NUC129 domain shown below is 1.1e-34.
YMAVRLKDEDLRDSRQEAAKHFIHSCLYGSDSKRTTVNKFLSLNNKRSPVKKAAAQFLTS TWG
NUC129 |
 |
|---|
| PFAM accession number: | PF08157 |
|---|---|
| Interpro abstract (IPR012579): | This entry represents the C-terminal domain of the nucleolar protein 7 (NOL7). Human NOL7 is a tumour suppressor [ (PUBMED:22123719) ]. |
| GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUC129