The domain within your query sequence starts at position 424 and ends at position 490; the E-value for the NUC202 domain shown below is 8.6e-30.

PYSTIRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLCSTRGSS
DGGLQSG

NUC202

NUC202
PFAM accession number:PF08166
Interpro abstract (IPR012980):

This domain is found in a novel family of nucleolar proteins [(PUBMED:15112237)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUC202