The domain within your query sequence starts at position 135 and ends at position 309; the E-value for the NUDE_C domain shown below is 6.6e-49.

SLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKS
APSSPTLDCEKMDSAVQASLSLPATPVGKGTENSFPSPKAIPNGFGTSPLTPSARISALN
IVGDLLRKVGALESKLAACRNFAKDQASRKSYVPGSVNCGVMNSNGPECPRSGRA

NUDE_C

NUDE_C
PFAM accession number:PF04880
Interpro abstract (IPR006964):

This entry represents the conserved region of NUDE proteins. Emericella nidulans (Aspergillus nidulans) NUDE, acts in the cytoplasmic dynein/dynactin pathway and is required for distribution of nuclei [(PUBMED:11509576)]. It is a homologue of the nuclear distribution protein RO11 of Neurospora crassa. NUDE interacts with the NUDF via an N-terminal coiled coil domain; this is the only domain which is absolutely required for NUDE function.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUDE_C