The domain within your query sequence starts at position 46 and ends at position 162; the E-value for the NUDIX-like domain shown below is 2.3e-20.
TGVFYLFHDLDPLLQASGHRYLVPRLSRAELEGLLGKFGQDSQRIEDSVLVGCSEQQEAW FALDLGLKSASSSRASLPKSEMEAELGGSFIKLRQALFQLNSVDSSLLFTAQALLRW
NUDIX-like |
 |
|---|
| PFAM accession number: | PF09296 |
|---|---|
| Interpro abstract (IPR015375): | This entry represents the N-terminal domain found in NADH pyrophosphatase. Nitrate reductase inactivator (NRI) protein shares 51.1-68.3% of its amino acid sequence with three types of the nucleotide pyrophosphatase-like protein from Arabidopsis thaliana. |
| GO function: | hydrolase activity (GO:0016787) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUDIX-like