The domain within your query sequence starts at position 35 and ends at position 222; the E-value for the NUDIX_2 domain shown below is 9.9e-85.

RTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHV
LLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFE
PPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISS
LPQLLSRF

NUDIX_2

NUDIX_2
PFAM accession number:PF13869
Interpro abstract (IPR016706):

This entry represents cleavage and polyadenylation specificity factor subunit 5, also known as the cleavage and polyadenylation specificity factor 25 kDa subunit. These proteins are a component of the cleavage factor Im (CFIm) complex involved in pre-mRNA 3' end processing [(PUBMED:9659921)]. CFIm may also play a role in regulation of poly(A) site selection [(PUBMED:20695905)].

GO process:mRNA polyadenylation (GO:0006378)
GO component:mRNA cleavage factor complex (GO:0005849)
GO function:mRNA binding (GO:0003729)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUDIX_2