The domain within your query sequence starts at position 22 and ends at position 198; the E-value for the NUDIX_5 domain shown below is 8.1e-85.

SLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQSNSEIAQGILDYVVETTKPISP
ANQGIKGKRVVLMRKFPLDGEKTGREAALFIVPSVVKDNTKYAYTPGCPIFYCLQDIMRV
CSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRPSPLERIKTNVINPAYAAE

NUDIX_5

NUDIX_5
PFAM accession number:PF16705
Interpro abstract (IPR032022):

This domain is found in higher eukaryotes at the N terminus of KRIT1 or Krev interaction trapped proteins. It carries three NPxY-like motifs and is found to bind the integrin cytoplasmic-associated protein 1 (ICAP1). In the absence of KRIT1, ICAP1 binds via its C-terminal PH/PTB fold domain to the integrin beta-1 cytoplasmic tail. Binding of KRIT1 to ICAP1 via this domain out-competes the binding of ICAP1 to integrin cytoplasmic tails such that ICAP1 is sequestered in the nucleus. Integrin activation is thus prevented [(PUBMED:23317506)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUDIX_5