The domain within your query sequence starts at position 90 and ends at position 685; the E-value for the NUFIP2 domain shown below is 2.4e-292.

KKKTGYGEINGNAGEREISLKSLSSDEATNPISRVLNGNQQVVETSLKQTVKTSTFGKAG
IKTKNFIQKNSMDKKNGKSYENKSGETQAVDKTDTIAIPNGVITSSSGYITNGYMSKGAD
NDGSGSESGYTTPKKRKARRNSAKGCENLNLVQDKIMQETSVPALKQGLETLKPDYSEQK
GMRVDGSKPIWKYETGPGGTSRGKPAMGDVLRKSSDIKPGLSSKKFDDRPKGKHASAAAS
KEDSWTLFKPPPVFPVDNSSAKIVPKISYASKVKENLNKTVQNSSVSPSSSSSSSSTGET
QTQSSSRLSQVPMSALKSVTSASFSNGPVLAGTDGSVYPSGGQPLLTTAANTLTPISTGT
DSVLQDMSLASAAVEQIKSSLFIYPSNMQTVLLSAQVDLPSQTDQQNLGDIFQNQWGLSF
INEPSAGPETVIGKSSDHKVMEVTFQGEYPATLVSQGAEIIPSGTEHPVFPKAYELEKRT
SPQVLGHILKPGTTESGALSLDPSHIGDLQKADTSSQGALVFLSKDYEIENQNPLASPTN
TLLGSAKEQRYQRGLERNDSWGSFDLRAAIVYHTKEMESIWNLQKQDPKRIITYNE

NUFIP2

NUFIP2
PFAM accession number:PF15293
Interpro abstract (IPR032747): Nuclear fragile X mental retardation-interacting protein 2 (NUFIP2, also known as 82-FIP) is an RNA binding protein that shows a cell cycle-dependent intracellular localisation [(PUBMED:12837692)].
GO function:RNA binding (GO:0003723)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUFIP2