SMART: Pfam domain NUP50

The domain within your query sequence starts at position 2 and ends at position 73; the E-value for the NUP50 domain shown below is 1.8e-15.

AKKNAKKEATARNWQGDAEEEGTFSLASEDVLRNRTIKRAKRRHARPQPNGKGTSKGIKS
LAVPSGRGEFRG

NUP50

PFAM accession number:	PF08911
Interpro abstract (IPR015007):	This entry represents a domain found in Nup2, 50 and 61, which are components of the nuclear pore complex. Nucleoporin 50kDa (NUP50) acts as a cofactor for the importin-alpha:importin-beta heterodimer, which in turn allows for transportation of many nuclear-targeted proteins through nuclear pore complexes. The C terminus of NUP50 binds importin-beta through RAN-GTP, the N terminus binds the C terminus of importin-alpha, while a central domain binds importin-beta. NUP50:importin-alpha:importin-beta then binds cargo and can stimulate nuclear import. The N-terminal domain of NUP50 is also able to actively displace nuclear localisation signals from importin-alpha [ (PUBMED:16222336) ]. NUP2 encodes a non-essential nuclear pore protein that has a central domain similar to those of Nsp1 and Nup1[ (PUBMED:8443417) (PUBMED:9442897) ]. Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope [ (PUBMED:9442897) (PUBMED:9640541) (PUBMED:9630243) ]. The structure of the vertebrate NPC has been studied extensively; recent reviews include [ (PUBMED:8311839) (PUBMED:8740526) (PUBMED:7574503) (PUBMED:7537513) ]. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate [ (PUBMED:8227139) (PUBMED:9659919) ]. Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches [ (PUBMED:9442897) (PUBMED:9159086) (PUBMED:7638906) (PUBMED:7688974) ]. nup2 mutants show genetic interactions with nsp1 and nup1 conditional alleles [ (PUBMED:8443417) (PUBMED:9442897) ]. Nup1 interacts with the nuclear import factor Srp1 [ (PUBMED:8045927) ] and with the small GTPase Ran (encoded by GSP1) [ (PUBMED:7638224) ].
GO component:	nuclear pore (GO:0005643)

PFAM accession number:

PF08911

Interpro abstract (IPR015007):

This entry represents a domain found in Nup2, 50 and 61, which are components of the nuclear pore complex.

Nucleoporin 50kDa (NUP50) acts as a cofactor for the importin-alpha:importin-beta heterodimer, which in turn allows for transportation of many nuclear-targeted proteins through nuclear pore complexes. The C terminus of NUP50 binds importin-beta through RAN-GTP, the N terminus binds the C terminus of importin-alpha, while a central domain binds importin-beta. NUP50:importin-alpha:importin-beta then binds cargo and can stimulate nuclear import. The N-terminal domain of NUP50 is also able to actively displace nuclear localisation signals from importin-alpha [ (PUBMED:16222336) ].

NUP2 encodes a non-essential nuclear pore protein that has a central domain similar to those of Nsp1 and Nup1[ (PUBMED:8443417) (PUBMED:9442897) ]. Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope [ (PUBMED:9442897) (PUBMED:9640541) (PUBMED:9630243) ]. The structure of the vertebrate NPC has been studied extensively; recent reviews include [ (PUBMED:8311839) (PUBMED:8740526) (PUBMED:7574503) (PUBMED:7537513) ]. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate [ (PUBMED:8227139) (PUBMED:9659919) ]. Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches [ (PUBMED:9442897) (PUBMED:9159086) (PUBMED:7638906) (PUBMED:7688974) ]. nup2 mutants show genetic interactions with nsp1 and nup1 conditional alleles [ (PUBMED:8443417) (PUBMED:9442897) ]. Nup1 interacts with the nuclear import factor Srp1 [ (PUBMED:8045927) ] and with the small GTPase Ran (encoded by GSP1) [ (PUBMED:7638224) ].

GO component:

nuclear pore (GO:0005643)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUP50