The domain within your query sequence starts at position 256 and ends at position 421; the E-value for the NUSAP domain shown below is 2.3e-72.
CPQGHSATKMNVRFSAATKDNEHKCSLTKTPARKSPHVTAPGSASKGQAVFRTPKSKATE RTSIAVITPFKLMTEATQTPSSSKKPVFDLKASLSRPLNYKPHKGKLKPWGQAKENNSLN ERVSRVTFHRKTYKQPHLQTREERWKRQEQERKEKKEKLLEARRNL
NUSAP |
![]() |
---|
PFAM accession number: | PF16006 |
---|---|
Interpro abstract (IPR026756): | Nucleolar and spindle-associated protein 1 (NuSAP) is a microtubule-associated protein with the capacity to bundle and stabilise microtubules [ (PUBMED:12963707) ]. When overexpressed, it causes profound cytoplasmic microtubule bundling in interphase cells. It localises to the spindle during mitosis. NuSAP depletion by RNA interference results in defect in spindle midzone formation and aberrant anaphase and cytokinesis [ (PUBMED:12963707) ]. NuSAP may be regulated by phosphorylation during mitosis [ (PUBMED:22101338) (PUBMED:19786723) (PUBMED:18669648) ]. NuSAP is indispensable for mitosis and may play an important role in cancer progression and aggressiveness [ (PUBMED:16170025) (PUBMED:17960622) (PUBMED:19915147) (PUBMED:20388846) (PUBMED:20053754) (PUBMED:19266279) ]. |
GO process: | mitotic cytokinesis (GO:0000281), microtubule cytoskeleton organization (GO:0000226), establishment of mitotic spindle localization (GO:0040001) |
GO component: | microtubule (GO:0005874), spindle (GO:0005819) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUSAP