The domain within your query sequence starts at position 900 and ends at position 1123; the E-value for the NUT domain shown below is 6.7e-40.

QVTILDVKDDSCPQPGVSKDSCLSNFNSYNLQGEGREDTVSSKPTDLVPLQDNQESYTHE
TTKLTNGQGQGSTSPRWATRDAYILRETPIKEKCTSADRAKRRETEKEEEDEELSNFSYL
LASKLSLSSGGLPLSTRQASGGQGIVKTSRHSTEVDDLGQPSPPPKSGKQALVGSPATVV
ERDQQGAQFNGSGQKPLALGMAQLPQPRKRRRDGFVTSKRKKRR

NUT

NUT
PFAM accession number:PF12881
Interpro abstract (IPR024309):

This domain is found in the N-terminal region of Nuclear Testis (NUT) proteins. The NUT gene is found fused to BRD3 or BRD4 genes in some aggressive types of carcinoma, due to chromosomal translocations [(PUBMED:12543779), (PUBMED:17934517)]. The BRD family proteins contain two bromodomains that bind transcriptionally active chromatin through associations with acetylated histones H3 and H4 [(PUBMED:12543779), (PUBMED:17934517)]. BRD proteins are crucial for the regulation of cell cycle progression.

The function of NUT proteins is not clear. NUT proteins contain the Nuclear Export Sequence (NES) and the Nuclear Localisation Signal (NLS), both located towards the C-terminal end of the protein [(PUBMED:12543779), (PUBMED:17934517)]. NUT-GFP protein showed either cytoplasmic or nuclear localisation, suggesting that it is subject to nuclear/cytoplasmic shuttling. Consistent with this possibility, treatment with leptomycin B an inhibitor of CRM1-dependent nuclear export resulted in re-distribution of NUT-GFP to the nucleus [(PUBMED:9323133), (PUBMED:9311922)]. Inspection of NUT revealed a C-terminal sequence similar to known nuclear export NUT protein carries some natively unstructured sequence.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NUT