The domain within your query sequence starts at position 43 and ends at position 448; the E-value for the NYAP_N domain shown below is 1.9e-127.

ARENDRLRNETNLAYLKEKNEKRRRQEETIKRIGGEVGRGQDASYAGKHFRMGFMTMPAP
QDRLPHPCSSGFTVRSQSLHSVGGTEDDSSCGSRRQPPPKPKRDPSTKLSTSSETVNSTA
ASKSGRSLERAEGKFTVPASHSPPRASTSGHLFPSPGSQERNIKVSAKPRPHSDEYSKKI
PPPKPKRNPNTQLSTSFDETYIKKHVPRRTSLPRDSSLSQVCSPAADPEEEEPVYIEMVG
NILRDFRKEEDDQSEAVYEEMKYPIFDDLGHDSKCDFDHHSCSSQCATPTVPDLDFVKSS
GPCTPKGLLCDIPPPFPNLLSHRPPLLVFPPAPVHCSPNSDESPLTPLEVTKLPVLENVS
YMKQPPGACPSSLPSHGSSHAKDQTGALGPAPGASILSSSPPPPST

NYAP_N

NYAP_N
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NYAP_N