The domain within your query sequence starts at position 1 and ends at position 534; the E-value for the NYD-SP12_N domain shown below is < 1e-12.

MDSGKSRSLETTVKRVYRDLLLPKINTSKKMSTLTNSPSSLEGTPGIKKNSGEMQAEASA
ERVKLTKSIKEKQNNELEKVALKRKADSEEKLVGKKEAKIMELDNQLVTTVPLPHIPLKN
IMDVEMKLVYVDEEDVSYEFAQPNMCLGLQATGQTATTMPPASPRDLTTLPQIDKWLQVA
LKDASSCYRQKKYAVAAGQFRTALELCSKGAALGKPFEAHAEDIASIASFIETKLVTCYL
RMRKPDLALNHAHRSIVLNPAYFRNHLRQAAVFRCLERYSEAARSAMIADYMFWLCGGSE
HSVSKLIKLYWQAMIEEAITRAEAFSVMYTPFATRIKPENIEKVKEVFMRTHPTYVDCIY
TDTQGLHVLPQTADWSCFPPQQYLLTLGFKNKEDGKFLEKVSSRKLPTYTEHKTPFSPLT
REDTVRHMETVGKRILPILDFIRSTQLNGNFHACSGVMEKLHYASLLSRLQRVKEQAQVI
NQAMAELATVPYLQDISQQEAELLQSLMADAMDTLEGKKSDKERVWNTIQKVKF

NYD-SP12_N

NYD-SP12_N
PFAM accession number:PF15015
Interpro abstract (IPR029161):

NYD-SP12, also known as SPATA16, is a germ-cell specific participant in the Golgi apparatus, and its expression is confined to spermatogenic epithelium, not being found in interstitial cells [(PUBMED:12529416)]. Computer analysis of the protein-sequence showed that NYD-SP12 contains a cluster of phosphorylation sites for protein kinase C as well as for cyclic nucleotide-dependent protein kinases [(PUBMED:17665087), (PUBMED:17847006)]. It has been postulated that, since the mutation of some Golgi apparatus proteins is responsible for male infertility, NYD-SP12 might play a role in modification and sorting of acrosomal enzymes [(PUBMED:17847006)].

GO process:spermatogenesis (GO:0007283)
GO component:Golgi apparatus (GO:0005794)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NYD-SP12_N