SMART: Pfam domain NYD-SP28

The domain within your query sequence starts at position 100 and ends at position 200; the E-value for the NYD-SP28 domain shown below is 1.7e-33.

AADVREIHRRVEEEETKRQRLEKLENEVKTSQDKFDEITAKWEEGRRKRIPQELWEMLNS
QQVHCAELIEDKNKLANELQQELKIKDDQYVKDLKKQSEDI

NYD-SP28

PFAM accession number:	PF14772
Interpro abstract (IPR039505):	This entry represents the N-terminal domain of dynein regulatory complex protein 1/2 (DRC1/2). DRC1 is a key component of the nexin-dynein regulatory complex (N-DRC), essential for N-DRC integrity. It is required for the assembly and regulation of specific classes of inner dynein arm motors. It may also function to restrict dynein-driven microtubule sliding, thus aiding in the generation of ciliary bending [ (PUBMED:23354437) ]. Mutations of DRC1 gene cause Ciliary dyskinesia, primary, 21 (CILD21), which is a disorder characterised by abnormalities of motile cilia [ (PUBMED:23354437) ]. DRC2, also known as CCDC65, is an essential component of the nexin-dynein regulatory complex [ (PUBMED:24094744) ].

PFAM accession number:

PF14772

Interpro abstract (IPR039505):

This entry represents the N-terminal domain of dynein regulatory complex protein 1/2 (DRC1/2). DRC1 is a key component of the nexin-dynein regulatory complex (N-DRC), essential for N-DRC integrity. It is required for the assembly and regulation of specific classes of inner dynein arm motors. It may also function to restrict dynein-driven microtubule sliding, thus aiding in the generation of ciliary bending [ (PUBMED:23354437) ].

Mutations of DRC1 gene cause Ciliary dyskinesia, primary, 21 (CILD21), which is a disorder characterised by abnormalities of motile cilia [ (PUBMED:23354437) ].

DRC2, also known as CCDC65, is an essential component of the nexin-dynein regulatory complex [ (PUBMED:24094744) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NYD-SP28