The domain within your query sequence starts at position 100 and ends at position 200; the E-value for the NYD-SP28 domain shown below is 1.7e-33.

AADVREIHRRVEEEETKRQRLEKLENEVKTSQDKFDEITAKWEEGRRKRIPQELWEMLNS
QQVHCAELIEDKNKLANELQQELKIKDDQYVKDLKKQSEDI

NYD-SP28

NYD-SP28
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NYD-SP28