The domain within your query sequence starts at position 113 and ends at position 256; the E-value for the Na_Pi_cotrans domain shown below is 7.4e-28.

LFVCSLDVLSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVS
MVSSGLLEVSSAIPIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVL
VLLPLEAATGYLHHVTGLVVASFN

Na_Pi_cotrans

Na_Pi_cotrans
PFAM accession number:PF02690
Interpro abstract (IPR003841):

This family consists of sodium-dependent phosphate transport proteins of the solute carrier family SLC34A [ (PUBMED:12750889) ]. It includes mammalian type II renal Na+/Pi-cotransporters and other proteins from lower eukaryotes and bacteria, some of which are also Na+/Pi-cotransporters. In kidneys these proteins may be involved in actively transporting phosphate into cells via Na+ cotransport in the renal brush border membrane [ (PUBMED:8327470) ].

GO process:sodium-dependent phosphate transport (GO:0044341)
GO component:membrane (GO:0016020)
GO function:sodium:phosphate symporter activity (GO:0005436)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Na_Pi_cotrans