The domain within your query sequence starts at position 573 and ends at position 832; the E-value for the Na_sulph_symp domain shown below is 2.4e-7.
KVLALEHLLAQRLHTFHRQISQEDKNWETNIQELQRKHRISDRSLLVKCLTVLGFVISMF FLNSFVPGIHLDLGWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAALFVLMEALTH LHLVEYVGEQTALLIKMVPEDQRFAAAIVLIVWVSALASSLIDNIPFTATMIPVLLNLSQ DPEISLPALPLMYALALGACLGGNGTLIGASTNVVCAGIAEKHGYGFSFMEFFRLGFPVM LMSCTIGMCYLLIAHIVVGW
Na_sulph_symp |
---|
PFAM accession number: | PF00939 |
---|---|
Interpro abstract (IPR001898): | Integral membrane proteins that mediate the intake of a wide variety of molecules with the concomitant uptake of sodium ions (sodium symporters) can be grouped, on the basis of sequence and functional similarities into a number of distinct families. The SLC13 family consists mainly of dicarboxylate and sulfate transporters [ (PUBMED:16211368) (PUBMED:23506872) ], and includes of the following proteins:
These transporters are proteins of from 430 to 620 amino acids which are highly hydrophobic and which probably contain about 12 transmembrane regions. |
GO process: | transmembrane transport (GO:0055085) |
GO component: | membrane (GO:0016020) |
GO function: | transmembrane transporter activity (GO:0022857) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Na_sulph_symp