The domain within your query sequence starts at position 573 and ends at position 832; the E-value for the Na_sulph_symp domain shown below is 6e-13.

KVLALEHLLAQRLHTFHRQISQEDKNWETNIQELQRKHRISDRSLLVKCLTVLGFVISMF
FLNSFVPGIHLDLGWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAALFVLMEALTH
LHLVEYVGEQTALLIKMVPEDQRFAAAIVLIVWVSALASSLIDNIPFTATMIPVLLNLSQ
DPEISLPALPLMYALALGACLGGNGTLIGASTNVVCAGIAEKHGYGFSFMEFFRLGFPVM
LMSCTIGMCYLLIAHIVVGW

Na_sulph_symp

Na_sulph_symp
PFAM accession number:PF00939
Interpro abstract (IPR001898):

Integral membrane proteins that mediate the intake of a wide variety of molecules with the concomitant uptake of sodium ions (sodium symporters) can be grouped, on the basis of sequence and functional similarities into a number of distinct families. The SLC13 family consists mainly of dicarboxylate and sulfate transporters [(PUBMED:16211368), (PUBMED:23506872)], and includes of the following proteins:

These transporters are proteins of from 430 to 620 amino acids which are highly hydrophobic and which probably contain about 12 transmembrane regions.

GO process:transmembrane transport (GO:0055085), sodium ion transport (GO:0006814)
GO component:membrane (GO:0016020)
GO function:transporter activity (GO:0005215)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Na_sulph_symp