The domain within your query sequence starts at position 1 and ends at position 182; the E-value for the Na_trans_assoc domain shown below is 2.2e-44.

EFIQQSFVKKQKILDEIKPLDDLNNRKDNCISNHTTEIGKDLDCLKDVNGTTSGIGTGSS
VEKYIIDESDYMSFINNPSLTVTVPIAVGESDFENLNTEDFSSESDLEESKEKLNESSSS
SEGSTVDIGAPAEEQPVIEPEETLEPEACFTEGCVQRFKCCQISVEEGRGKQWWNLRRTC
FR

Na_trans_assoc

Na_trans_assoc
PFAM accession number:PF06512
Interpro abstract (IPR010526):

Members of this entry contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of IPR005821 and, less often, one copy of IPR000048.

GO process:sodium ion transport (GO:0006814)
GO component:voltage-gated sodium channel complex (GO:0001518)
GO function:voltage-gated sodium channel activity (GO:0005248)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Na_trans_assoc