The domain within your query sequence starts at position 972 and ends at position 1191; the E-value for the Na_trans_assoc domain shown below is 2.9e-72.
DTDANNLQIAVARIKRGINYVKQTLREFILKSFSKKPKGSKDTKRTADPNNKRENYISNR TLAEISKDHNFLKEKDKISGFSSSLDKSFMDENDYQSFIHNPSLTVTVPIAPGESDLENM NTEELSSDSDSDYSKERRNRSSSSECSTVDNPLPGEEEAEAEPINADEPEACFTDGCVRR FPCCQVNIDSGKGKVWWTIRKTCYRIVEHSWFESFIVLMI
Na_trans_assoc |
![]() |
---|
PFAM accession number: | PF06512 |
---|---|
Interpro abstract (IPR010526): | Members of this entry contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of IPR005821 and, less often, one copy of IPR000048. |
GO process: | sodium ion transport (GO:0006814) |
GO component: | voltage-gated sodium channel complex (GO:0001518) |
GO function: | voltage-gated sodium channel activity (GO:0005248) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Na_trans_assoc