The domain within your query sequence starts at position 263 and ends at position 658; the E-value for the NatB_MDM20 domain shown below is 1.6e-121.

WQFYLTYFDSVFRLIEEAWTPPAEGEHSLEGEVHCSAEDAVKFIEDRITEASQSSRHVRG
PHLAKLELIRRLRSQGCNDEYKLGDPEELMFQYFKKFGDKPCCFTDLKVFVDLLPAAQCT
QFINQLLGVVPLSTPTEDKLALPADIRGLQQHLCVVQLTRLLGLYHSMDKSQKLDVVKEL
MLRYQHGLEFGRSCLKTELQFSDYYCLLAVHVLIDVWREAGEETAVWQALTLLEEGLTHS
PSNAQFKLLLVRIYCVLGAFEPVVDLYSSLDAKHIQHDTIGYLLTRYAASLGQYAAASQS
CNFALRFFHSNQKDTSEYIIQAYKYGAFEKIPEFIAFRNRLNNSLHFAQVRTERMLLDLL
LEANISISLAESIKSMNLRPEEDDVPWEDLRDNRDL

NatB_MDM20

NatB_MDM20
PFAM accession number:PF09797
Interpro abstract (IPR019183):

This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB). The NatB complex catalyses the acetylation of the amino-terminal methionine residue of all proteins beginning with Met-Asp or Met-Glu and of some proteins beginning with Met-Asn or Met-Met. In Saccharomyces cerevisiae (Baker's yeast) this subunit is called MDM20 and in Schizosaccharomyces pombe (Fission yeast) it is called Arm1. NatB acetylates the Tpm1 protein and regulates and tropomyocin-actin interactions. This subunit is required by the NatB complex for the N-terminal acetylation of Tpm1 [(PUBMED:12808144)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NatB_MDM20