The domain within your query sequence starts at position 89 and ends at position 370; the E-value for the Nbas_N domain shown below is 4.7e-171.

WHLVLANNGKLLAAVQDQCVEIRSAKDDFTSIIGKCQVPKDPKPQWRRVAWSYDCTLLAY
AESTGTVRVFDLMGSELFVIAPASVFAGDLSYAIAGLVFLEYKASAQWSAELLVINYRGE
LRSYLVSVGTNQSYQESHSFSFSGHYPHGINTAIYHPGHRLLLVGGCETAELGISKAASC
GLSAWRVLSGSPYYKQVTNGGDRVTEVPKTLGLLKLLSVKLSPRLGQEQDGIFKMGLSPD
GSLLAAIHFSGKLSIWAIPSLKQQGVWRQDEQPGYNELNPDW

Nbas_N

Nbas_N
PFAM accession number:PF15492
Interpro abstract (IPR029145):

This entry represents the N-terminal domain of the neuroblastoma-amplified sequence (NBAS). This domain can also be found at the N terminus of several WD40-containing proteins. NBAS from human is over-expressed in neuroblastoma cells [(PUBMED:10882752)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nbas_N