The domain within your query sequence starts at position 20 and ends at position 76; the E-value for the Nbl1_Borealin_N domain shown below is 1.9e-20.

KLASFLKDFDREVQVRTKQIESDRQTLLKEVENLYNIEILRLPKALQGMKWLDYFAL

Nbl1_Borealin_N

 Nbl1_Borealin_N
PFAM accession number:PF10444
Interpro abstract (IPR018851):

This entry represents the N-terminal domain of borealin, a component of the chromosomal passenger complex (CPC), which acts as a key regulator of mitosis [ (PUBMED:15249581) (PUBMED:23175282) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nbl1_Borealin_N