The domain within your query sequence starts at position 51 and ends at position 204; the E-value for the Ndc80_HEC domain shown below is 3.6e-54.

ERKVSIFGKRTSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLYEFLTENGYVY
SVSMKSLQAPSTKEFLKIFAFLYGFLCPSYELPGTKCEEEVPRIFKALGYPFTLSKSSMY
TVGAPHTWPHIVAALVWLIDCIKIDTAMKESSPL

Ndc80_HEC

• PFAM accession number: PF03801
• Interpro abstract (IPR005550):

  Members of this family are components of the mitotic spindle. It has been shown that Ndc80 from yeast is part of a complex called the Ndc80p complex [ (PUBMED:11266451) ]. This complex is thought to bind to the microtubules of the spindle.

• GO process: attachment of mitotic spindle microtubules to kinetochore (GO:0051315)
• GO component: Ndc80 complex (GO:0031262)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ndc80_HEC