The domain within your query sequence starts at position 252 and ends at position 290; the E-value for the Neil1-DNA_bind domain shown below is 2.2e-28.

DFAAFRAWLRCYGVPGMSSLRDRHGRTIWFQGDPGPLAP

Neil1-DNA_bind

 Neil1-DNA_bind
PFAM accession number:PF09292
Interpro abstract (IPR015371):

This domain is predominantly found in Endonuclease VIII-like 1 proteins and adopts a glucocorticoid receptor-like fold. Structural analysis reveals a zincless finger motif that is required for glycosylase activity [ (PUBMED:15232006) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neil1-DNA_bind