The domain within your query sequence starts at position 1126 and ends at position 1425; the E-value for the Neogenin_C domain shown below is 5.5e-129.
KDLRPPDLWIHHEEMEMKNIEKPTGTDPAGRDSPIQSCQDLTPVSHSQSETQMGSKSASH SGQDTEDAGSSMSTLERSLAARRATRAKLMIPMEAQSSNPAVVSAIPVPTLESAQYPGIL PSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRTQSVSEGPTTQQQPMLPPAQPEHPSSEE APSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLG LAGKARSPLLPVSVPTAPEVSEESHKPTEDPASVYEQDDLSEQMASLEGLMKQLNAITGS
Neogenin_C |
---|
PFAM accession number: | PF06583 |
---|---|
Interpro abstract (IPR010560): | This entry represents the C terminus of eukaryotic neogenin precursor proteins, which contains several potential phosphorylation sites [ (PUBMED:9121761) ]. Neogenin is a member of the N-CAM family of cell adhesion molecules (and therefore contains multiple copies of IPR007110 and IPR003961 ) and is closely related to the DCC tumour suppressor gene product - these proteins may play an integral role in regulating differentiation programmes and/or cell migration events within many adult and embryonic tissues [ (PUBMED:9264410) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neogenin_C