The domain within your query sequence starts at position 1126 and ends at position 1425; the E-value for the Neogenin_C domain shown below is 5.5e-129.

KDLRPPDLWIHHEEMEMKNIEKPTGTDPAGRDSPIQSCQDLTPVSHSQSETQMGSKSASH
SGQDTEDAGSSMSTLERSLAARRATRAKLMIPMEAQSSNPAVVSAIPVPTLESAQYPGIL
PSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRTQSVSEGPTTQQQPMLPPAQPEHPSSEE
APSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLG
LAGKARSPLLPVSVPTAPEVSEESHKPTEDPASVYEQDDLSEQMASLEGLMKQLNAITGS

Neogenin_C

Neogenin_C
PFAM accession number:PF06583
Interpro abstract (IPR010560):

This entry represents the C terminus of eukaryotic neogenin precursor proteins, which contains several potential phosphorylation sites [(PUBMED:9121761)]. Neogenin is a member of the N-CAM family of cell adhesion molecules (and therefore contains multiple copies of IPR007110 and IPR003961) and is closely related to the DCC tumour suppressor gene product - these proteins may play an integral role in regulating differentiation programmes and/or cell migration events within many adult and embryonic tissues [(PUBMED:9264410)].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neogenin_C