The domain within your query sequence starts at position 73 and ends at position 293; the E-value for the Neugrin domain shown below is 1.2e-99.

MEAPGAPPRTLTWEAMEQIRYLHKEFAESWSVPRLAEGFDVSTDVIRRVLKSKFVPTLEQ
KLRQDQKVLKKAGFTREIGQLPVSEDTLKALSAGRSVSGLLMAGDEVSSKSQNHSTALKV
AKSHPHSTDAQKKREGRDKRIQVLEESLVPATTALGHQRELQKSATSDSEATGRAGSDTL
PSAVLLEELKPGEPGDQSFSSKVVQRGHDFFDSNGNFLYRI

Neugrin

Neugrin
PFAM accession number:PF06413
Interpro abstract (IPR010487):

This entry include neugrin from mammals and Rrg9 from fungi. Neugrin is mainly expressed in neurons and may play an important role in the process of neuronal differentiation [(PUBMED:11118320)]. Rrg9 is required for respiratory activity and maintenance and expression of the mitochondrial genome [(PUBMED:19751518)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neugrin