The domain within your query sequence starts at position 447 and ends at position 565; the E-value for the Neural_ProG_Cyt domain shown below is 5.8e-73.

LYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNVRKFCDTPRVSSPHARALAH
YDNIVCQDDPSAPHKIQDPLKSRLKEEESFNIQNSMSPKLEGGKGDQDDLGVNCLQNNL

Neural_ProG_Cyt

Neural_ProG_Cyt
PFAM accession number:PF06567
Interpro abstract (IPR009505):

This entry represents the C-terminal cytoplasmic domain of vertebrate neural chondroitin sulphate proteoglycans that contain EGF modules. Evidence has been accumulated to support the idea that neural proteoglycans are involved in various cellular events including mitogenesis, differentiation, axonal outgrowth and synaptogenesis [ (PUBMED:9321696) ]. This domain contains a number of potential sites of phosphorylation by protein kinase C [ (PUBMED:9950058) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neural_ProG_Cyt