The domain within your query sequence starts at position 160 and ends at position 284; the E-value for the Neuro_bHLH domain shown below is 1.1e-47.

GKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNPDMPPHLPTASASFPVHPY
SYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSI
NGNFS

Neuro_bHLH

Neuro_bHLH
PFAM accession number:PF12533
Interpro abstract (IPR022575):

This functionally uncharacterised domain is found in eukaryotes, and is approximately 80 amino acids in length. There is a single completely conserved residue W that may be functionally important. It is found in neurogenic differentiation factors which are essential for neurogenesis. It is found C-terminal to the helix-loop-helix DNA binding domain .

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neuro_bHLH