The domain within your query sequence starts at position 28 and ends at position 90; the E-value for the Neuropep_like domain shown below is 2.8e-45.
AEPATGSAVPAQSRPCVDCHAFEFMQRALQDLRKTAYSLDARTETLLLQAERRALCACWP AGR
Neuropep_like |
---|
PFAM accession number: | PF15161 |
---|---|
Interpro abstract (IPR028147): | This family contains putative neuropeptides [ (PUBMED:21287218) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Neuropep_like