The domain within your query sequence starts at position 843 and ends at position 951; the E-value for the Nexin_C domain shown below is 1.9e-23.

WLCTESMQKFLHIIFGTLVQRWLEVQVANLTCPQRWAQYLHLLRESIWPGGVLPKFPRPG
RTQAQKAATEKQALQSLMDLLPDFLVEILGVNKCRLSWSLVLESFQQPL

Nexin_C

Nexin_C
PFAM accession number:PF08628
Interpro abstract (IPR013937):

This region is found at the C terminus of proteins belonging to the nexin family. It is found on proteins which also contain IPR001683.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nexin_C