The domain within your query sequence starts at position 93 and ends at position 263; the E-value for the Nitroreductase domain shown below is 3.5e-23.
LNKRRSVRFISSEHVPMEVIENVIKAAGTAPSGAHTEPWTFVVVKDPDMKHKIREIIEEE EEINYMKRMGKRWVTDLKKLRTNWIKEYLDTAPVLILIFKQVHGFAANGKKKVHYYNEIS VSIACGLLLAALQNAGLVTVTTTPLNCGPRLRVLLGRPSHEKLLVLLPVGY
Nitroreductase |
---|
PFAM accession number: | PF00881 |
---|---|
Interpro abstract (IPR029479): | The entry represents a domain found in a group of FMN- or FAD-dependent and NAD(P)H-dependent nitroreductases that are able to metabolise nitrosubstituted compounds [ (PUBMED:17331467) (PUBMED:8846223) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nitroreductase