The domain within your query sequence starts at position 62 and ends at position 214; the E-value for the Njmu-R1 domain shown below is 1.6e-84.
SPLPAKLTQNRGDSDDGRSGGINAETPSGDDFSLSLVDTNLPSEVEPELRSFIAKRLSKG AVFEGLGNVASVELRIPGYRVGCYYCLFQQEKLLPEIAAMESEHNPSEYVVCFLGGSEKG LELFRLELDKYIQGLKNNMNCEERSLGNDVKSY
Njmu-R1 |
---|
PFAM accession number: | PF15053 |
---|---|
Interpro abstract (IPR028280): | This entry represents the eukaryotic protein Njmu-R1, which may play a role in spermatogenesis. In humans, it is found in chromosome 17 open reading frame 75 (C17orf75). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Njmu-R1