The domain within your query sequence starts at position 12 and ends at position 141; the E-value for the NmrA domain shown below is 7.3e-9.

YLVTGGCGFLGEHIVRMLLEREPRLRELRVFDLHLSSWLEELKAGPVQVTAIQGDVTQAH
EVAAAMSGSHVVIHTAGLVDVFGKASPKTIHKVNVQGTQNVIDACVQTGTQYLVYTSSME
VVGPNIKGHP

NmrA

NmrA
PFAM accession number:PF05368
Interpro abstract (IPR008030):

NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi [(PUBMED:11726498)]. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry NmrA