The domain within your query sequence starts at position 68 and ends at position 168; the E-value for the Nnf1 domain shown below is 2.4e-24.
EVTQRIYDKFVAQLQTSIREEISEIKEEGNLEAVLNSLDKIIEEGRERGEPAWRPSGIPE KDLCSVMAPYFLKQQDTLCHQVRKQEAKNQELADAVLAGRR
Nnf1 |
 |
|---|
| PFAM accession number: | PF03980 |
|---|---|
| Interpro abstract (IPR007128): | This entry includes polyamine-modulated factor 1 (PMF1) from animals and Nnf1 from yeasts. PMF1 is part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis [ (PUBMED:16585270) ]. Nnf1 is an essential component of the MIND kinetochore complex required for accurate chromosome segregation [ (PUBMED:12455957) ]. |
| GO component: | nuclear MIS12/MIND complex (GO:0000818) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nnf1