The domain within your query sequence starts at position 19 and ends at position 118; the E-value for the Noelin-1 domain shown below is 3.8e-44.

QSPEEGWQLYTSAQAPDGKCVCTAVIPAQSTCARDGRSRELRQLMEKVQNVSQSMEVLEL
RTFRDLQYVRSMETLMRSLDARLRAADGSVSAKSFQELKD

Noelin-1

Noelin-1
PFAM accession number:PF12308
Interpro abstract (IPR022082):

This domain is found in eukaryotes, and is approximately 100 amino acids in length. The family is found in association with. There are two conserved sequence motifs: SAQ and VQN. It is found in Noelin, a glycoprotein which is secreted mainly by postmitotic neurogenic tissues in the developing central and peripheral nervous systems, first appearing after neural tube closure [(PUBMED:11784068)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Noelin-1