The domain within your query sequence starts at position 10 and ends at position 94; the E-value for the Nop domain shown below is 6e-28.
CLWELGWHLVRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFS EVPTSVFGEKLREQVEERLSFYETG
Nop |
---|
PFAM accession number: | PF01798 |
---|---|
Interpro abstract (IPR002687): | The Nop domain is present in various pre-RNA processing ribonucleoproteins (RNP):
The Nop domain is a RNP binding module, exhibiting RNA and protein binding surfaces. It is oval-shaped and exclusively alpha-helical [ (PUBMED:12598892) (PUBMED:17412961) ]. This entry represents the Nop domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nop