The domain within your query sequence starts at position 10 and ends at position 94; the E-value for the Nop domain shown below is 6e-28.

CLWELGWHLVRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFS
EVPTSVFGEKLREQVEERLSFYETG

Nop

Nop
PFAM accession number:PF01798
Interpro abstract (IPR002687):

The Nop domain is present in various pre-RNA processing ribonucleoproteins (RNP):

  • Eukaryotic Prp31, part of a tri-snRNP complex. It is involved in pre-mRNA splicing.
  • Eukaryotic Nucleolar proteins 56 and 58 (Nop56 and Nop58), components of box C/D small nucleolar ribonucleoprotein (snoRNP) particles.
  • Archaeal Nop5, an homologue of Nop56/Nop58.

The Nop domain is a RNP binding module, exhibiting RNA and protein binding surfaces. It is oval-shaped and exclusively alpha-helical [(PUBMED:12598892), (PUBMED:17412961)].

This entry represents the Nop domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nop