The domain within your query sequence starts at position 44 and ends at position 127; the E-value for the Nop domain shown below is 1.1e-26.
GPAKGDRVSRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSE VPTSVFGEKLREQVEERLSFYETG
Nop |
![]() |
---|
PFAM accession number: | PF01798 |
---|---|
Interpro abstract (IPR002687): | The Nop domain is present in various pre-RNA processing ribonucleoproteins (RNP):
The Nop domain is a RNP binding module, exhibiting RNA and protein binding surfaces. It is oval-shaped and exclusively alpha-helical [(PUBMED:12598892), (PUBMED:17412961)]. This entry represents the Nop domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nop