The domain within your query sequence starts at position 21 and ends at position 849; the E-value for the Nop14 domain shown below is 2.2e-273.

SGGPAKTNPNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERNKS
NVFADKRFGEYNSNISPEEKMMKRFALEQQRYHEKKNIYNLNEDEELTHYGQSLADIEKH
NDIVDSDSDTEDRGALSAELTASHFGGGVHKNSSQKEGEDGDKPKTRKELIEELIAKSKQ
EKRERQAQREDALELTEKLDQDWKEIQILMSRKPKKSEDKEKKEKPQPDEYDMMVRELGF
EMKAQPSNRMKTEEELAKEEQERLKKLEAERLRRMLGKDEHENKKKPKHTSADDLNDGFI
LDKDDRRLLSYKDGKMNIEDVQEEQSKEADGQENDQKEGEDDSEEEDESHEDSEESEDPD
SHSDLESNIESEEENETPKKEQRQTPGGKLPKDDQKAQKAVAAELPYVFAAPESFEELKF
LLSGRSMEEQLLVVERIQKCNHPSLAVGNKAKLEKLFGFLLQYIGDLATDSTPDLKTIDK
LVVHLYSLCQMFPESASDSIRFVLRDAMHEMEEMIETKGRAAFPGLDVLIYLKITGLLFP
TSDFWHPVVTPALLCMSQMLTKCPVMSLQDVIKGLFVCCLFLEYVSLSRRFIPELFNFLL
GILYIATPNTKSQGSTLVHPFRALGKNSELLVVSDKADVTTWQRGSLPLHWANRLSTLTA
TEANHTRLSCVASCLSLMKHCVLMYQALPSFHAIFRPHQALLSKHLADCSLPQELQELAQ
SILSAMEGQKQHCRPLVCEKSKPVPLKQFTPRLVKVLEFGRKQGSSKEEQERKRLIHKHK
REFKGAVREIRKDNQFLARMQLSEIMERDAERKRKVKQLFNSLATQEGE

Nop14

Nop14
PFAM accession number:PF04147
Interpro abstract (IPR007276): Nucleolar protein 14 (Nop14) is involved in nucleolar processing of pre-18S ribosomal RNA and has a role in the nuclear export of 40S pre-ribosomal subunit to the cytoplasm [(PUBMED:12068309), (PUBMED:12446671)].
GO component:small-subunit processome (GO:0032040)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nop14