The domain within your query sequence starts at position 5 and ends at position 88; the E-value for the Nop16 domain shown below is 9.9e-11.
KGKTRRQKFGYNVNRKRLNRNARRKAAPRIECSHIRHAWDHTKSVRQNLAEMGLAMDPNK AVPLRKKKVKAMEVDTEERPRDLV
Nop16 |
---|
PFAM accession number: | PF09420 |
---|---|
Interpro abstract (IPR019002): | Nucleolar protein 16 (Nop16) is a protein involved in the biogenesis of the 60S ribosomal subunit. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nop16