The domain within your query sequence starts at position 11 and ends at position 219; the E-value for the Nop52 domain shown below is 5.3e-74.

IQLAQRLAGNEQVTRDRALRKLRKYIEARSQRATGGFTPDELLKVWKGLFYCMWMQDKPL
QQEELGRTIAQLVHAFHTTEAQHQFLKAFWQTMIREWVGIDRLRLDKFYMLMRMVLSESL
KAVKARGWDERQIEQLLELLTTEILNPDSQAPSGVKSHFLEIFLEELAKVGAAELTADQN
LQFIDPFCQIAARTKDSQVLHKIIQSIFQ

Nop52

Nop52
PFAM accession number:PF05997
Interpro abstract (IPR010301):

Nop52 is believed to be involved in the generation of 28S rRNA [(PUBMED:10341208)].

GO process:rRNA processing (GO:0006364)
GO component:preribosome, small subunit precursor (GO:0030688)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nop52