The domain within your query sequence starts at position 1 and ends at position 156; the E-value for the Nop53 domain shown below is 1.4e-47.

MCEGLLEESDGEDEHEAGRAGQPEAGDGTTEISPTGAAGPEKRMEKKTEQQRRREKAARK
LRVQQAALRAARLQHQELFRLRGIKAQVARRLAELARRREQRRIRRLAEADKPRRLGRLK
YQAPDIDVQLSSELSGSLRTLKPEGHILRDRFKSFQ

Nop53

Nop53
PFAM accession number:PF07767
Interpro abstract (IPR011687):

This entry includes glioma tumour suppressor candidate region gene 2 protein (GSCR2) from humans and ribosome biogenesis protein Nop53 from budding yeasts. GSCR2 bears similarity to the glioma tumour suppressor candidate region gene 2 protein (p60) [ (PUBMED:10708517) ]. Nop53 is a nucleolar protein that is involved in biogenesis of the 60S subunit of the ribosome [ (PUBMED:15686447) ]. It interacts with Nop17 and Nip7 and is required for pre-rRNA processing in Saccharomyces cerevisiae [ (PUBMED:16128814) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nop53