The domain within your query sequence starts at position 1 and ends at position 156; the E-value for the Nop53 domain shown below is 1.4e-47.
MCEGLLEESDGEDEHEAGRAGQPEAGDGTTEISPTGAAGPEKRMEKKTEQQRRREKAARK LRVQQAALRAARLQHQELFRLRGIKAQVARRLAELARRREQRRIRRLAEADKPRRLGRLK YQAPDIDVQLSSELSGSLRTLKPEGHILRDRFKSFQ
Nop53 |
---|
PFAM accession number: | PF07767 |
---|---|
Interpro abstract (IPR011687): | This entry includes glioma tumour suppressor candidate region gene 2 protein (GSCR2) from humans and ribosome biogenesis protein Nop53 from budding yeasts. GSCR2 bears similarity to the glioma tumour suppressor candidate region gene 2 protein (p60) [ (PUBMED:10708517) ]. Nop53 is a nucleolar protein that is involved in biogenesis of the 60S subunit of the ribosome [ (PUBMED:15686447) ]. It interacts with Nop17 and Nip7 and is required for pre-rRNA processing in Saccharomyces cerevisiae [ (PUBMED:16128814) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nop53