SMART: Pfam domain Npa1

The domain within your query sequence starts at position 78 and ends at position 396; the E-value for the Npa1 domain shown below is 1.5e-86.

CAEIFQLLSGEKRPESEMLLIFQAFEAILLRTASDLTHFHVVGANIVKKLLYNHMKLLCE
SLYASGYRMARACLDLMTAMVTQGPEAARDVCSSLDLNKKALFALVTKRDSKGVHDVRLA
YIQFALSFLIAGDDNTIGQVLEIKEFIPCIFSSGIKEDKISTINILLSTLKTKVIHNKNI
TKTQKVRFFTGQFLNHIAALYNWNGITDVTPEKPESAAISAEEAGKAMVRDLVHNFLMDL
CCSRKHGISFYDASLGTSGRGGNLTLLHFLLSLKTAAGDDLVASLVVSILKVCPDLLTKY
FKEVTFSFLPRVKSTWLNN

Npa1

PFAM accession number:	PF11707
Interpro abstract (IPR021714):	Nucleolar pre-ribosomal-associated protein 1 (Npa1) is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [ (PUBMED:15208443) ]. The protein partners of Npa1p include eight putative helicases as well as the novel Npa2p factor. Npa1p can also associate with a subset of H/ACA and C/D small nucleolar RNPs (snoRNPs) involved in the chemical modification of residues in the vicinity of the peptidyl transferase centre [ (PUBMED:15226434) ]. The protein has also been referred to as Urb1. This entry represents a domain is found at the N terminus of Npa1.

PFAM accession number:

PF11707

Interpro abstract (IPR021714):

Nucleolar pre-ribosomal-associated protein 1 (Npa1) is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [ (PUBMED:15208443) ]. The protein partners of Npa1p include eight putative helicases as well as the novel Npa2p factor. Npa1p can also associate with a subset of H/ACA and C/D small nucleolar RNPs (snoRNPs) involved in the chemical modification of residues in the vicinity of the peptidyl transferase centre [ (PUBMED:15226434) ]. The protein has also been referred to as Urb1.

This entry represents a domain is found at the N terminus of Npa1.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Npa1