The domain within your query sequence starts at position 90 and ends at position 474; the E-value for the Nramp domain shown below is 1.1e-122.

IESDLQSGAVAGFKLLWVLLLATIVGLLLQRLAARLGVVTGLHLAEVCHRQYPKVPRIIL
WLMVELAIIGSDMQEVIGSAIAINLLSAGRVPLWGGVLITIADTFVFLFLDKYGLRKLEA
FFGFLITIMALTFGYEYITVKPSQSQVLRGMFVPSCPGCRTPQVEQAVGIVGAVIMPHNM
YLHSALVKSRQVNRANKQEVREANKYFFIESCIALFVSFIINVFVVSVFAEAFFEKTNKQ
VVEVCKNNSSPHADLFPSDNSTLAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMT
GTYSGQFVMEGFLNLKWSRFARVILTRSIAIIPTLLVAVFQDVEHLTGMNDFLNVLQSLQ
LPFALIPILTFTSLRPVMSEFSNGI

Nramp

Nramp
PFAM accession number:PF01566
Interpro abstract (IPR001046):

The natural resistance-associated macrophage protein (NRAMP) family consists of Nramp1, Nramp2, and yeast proteins Smf1 and Smf2. The NRAMP family is a novel family of functionally related proteins defined by a conserved hydrophobic core of ten transmembrane domains [(PUBMED:7479731)]. Nramp1 is an integral membrane protein expressed exclusively in cells of the immune system and is recruited to the membrane of a phagosome upon phagocytosis. Nramp2 is a multiple divalent cation transporter for Fe2+, Mn2+ and Zn2+ amongst others. It is expressed at high levels in the intestine; and is major transferrin-independent iron uptake system in mammals [(PUBMED:9719491)]. The yeast proteins Smf1 and Smf2 may also transport divalent cations [(PUBMED:9632246)].

The natural resistance of mice to infection with intracellular parasites is controlled by the Bcg locus, which modulates the cytostatic/cytocidal activity of phagocytes. Nramp1, the gene responsible, is expressed exclusively in macrophages and poly-morphonuclear leukocytes, and encodes a polypeptide (natural resistance-associated macrophage protein) with features typical of integral membrane proteins. Other transporter proteins from a variety of sources also belong to this family.

GO process:metal ion transport (GO:0030001)
GO component:membrane (GO:0016020)
GO function:metal ion transmembrane transporter activity (GO:0046873)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nramp