The domain within your query sequence starts at position 25 and ends at position 202; the E-value for the Nt_Gln_amidase domain shown below is 2.9e-73.
YNSCYCEENIWKLCEYIKTHNQYLLEECYAVFISNEKKMVPIWKQQARPENGPVIWDYHV VLLHVSREGQSFIYDLDTILPFPCPFDIYIEDALKSDDDIHLQFRRKFRVVRADSYLKHF ASDRSHMKDSSGNWREPPPEYPCIETGDSKMNLNDFISMDPAVGWGAVYTLPEFVHRF
Nt_Gln_amidase |
---|
PFAM accession number: | PF09764 |
---|---|
Interpro abstract (IPR023128): | This entry represents a structural domain found in the N-terminal glutamine amidohydrolase (Nt Q -amidase) family of proteins. These proteins contain a region of approximately 200 residues carrying several distinctive motifs including a WDYHV motif and one of three cysteines. Protein N-terminal glutamine amidohydrolase is responsible for degradation of N-terminal glutamine [ (PUBMED:19560421) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nt_Gln_amidase