The domain within your query sequence starts at position 25 and ends at position 202; the E-value for the Nt_Gln_amidase domain shown below is 2.9e-73.

YNSCYCEENIWKLCEYIKTHNQYLLEECYAVFISNEKKMVPIWKQQARPENGPVIWDYHV
VLLHVSREGQSFIYDLDTILPFPCPFDIYIEDALKSDDDIHLQFRRKFRVVRADSYLKHF
ASDRSHMKDSSGNWREPPPEYPCIETGDSKMNLNDFISMDPAVGWGAVYTLPEFVHRF

Nt_Gln_amidase

Nt_Gln_amidase
PFAM accession number:PF09764
Interpro abstract (IPR023128):

This entry represents a structural domain found in the N-terminal glutamine amidohydrolase (NtQ-amidase) family of proteins. These proteins contain a region of approximately 200 residues carrying several distinctive motifs including a WDYHV motif and one of three cysteines. Protein N-terminal glutamine amidohydrolase is responsible for degradation of N-terminal glutamine [(PUBMED:19560421)].

GO function:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides (GO:0016811)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nt_Gln_amidase