The domain within your query sequence starts at position 1071 and ends at position 1117; the E-value for the Nuc_rec_co-act domain shown below is 6.5e-27.
ESPSDEGALLDQLYLALRNFDGLEEIDRALGIPELVSQSQAVDAEQF
Nuc_rec_co-act |
---|
PFAM accession number: | PF08815 |
---|---|
Interpro abstract (IPR014920): | This entry represents the interlocking domain of the eukaryotic nuclear receptor coactivators Ncoa1, Ncoa2 and Ncoa3. The interlocking domain forms a 3-helical non-globular array that forms interlocked heterodimers with its target. Nuclear receptors are ligand-activated transcription factors involved in the regulation of many processes, including development, reproduction and homeostasis. Nuclear receptor coactivators act to modulate the function of nuclear receptors. Coactivators associate with promoters and enhancers primarily through protein-protein contacts to facilitate the interaction between DNA-bound transcription factors and the transcription machinery. In addition to their role as coactivators of various nuclear receptors, Ncoa1 and Ncoa3 both have histone acetyltransferase activity ( EC 2.3.1.48 ), but Ncoa2 does not [ (PUBMED:14757047) (PUBMED:15145939) ]. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO component: | nucleus (GO:0005634) |
GO function: | nuclear hormone receptor binding (GO:0035257), transcription coactivator activity (GO:0003713) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nuc_rec_co-act