The domain within your query sequence starts at position 2 and ends at position 76; the E-value for the Nuc_recep-AF1 domain shown below is 4.3e-10.

PPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVL
GVRGLHCPPPPGGPG

Nuc_recep-AF1

Nuc_recep-AF1
PFAM accession number:PF11825
Interpro abstract (IPR021780):

Nuclear receptors (NRs) are a family of ligand-inducible transcription factors, and, like other transcription factors, they contain a distinct DNA binding domain that allows for target gene recognition and several activation domains that possess the ability to activate transcription [(PUBMED:12893880)]. One of these activation domains is at the N-terminal, although there are two distinct motifs within this domain, between residues 20-36 and between 74 and the end of this domain, which are the binding regions. One of the co-activators is TIF1beta, which appears to bind at the first motif [(PUBMED:19321449)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nuc_recep-AF1