The domain within your query sequence starts at position 43 and ends at position 226; the E-value for the Nuc_sug_transp domain shown below is 1.7e-12.

SFKHPFVQAVGMFLGEFSCLAAFYLLKCQGRRQSASSVEPQQPFNTLLFLPPALCDMTGT
SIMYVALNMTSASSFQMLRGAVIIFTGLFSVAFLDRRLAPSQWLGILITIAGLVVVGLAD
LLSKHDSQHKLSEVITGDLLIIMAQIIIAIQMVLEEKFVYKHNIHPLQAVGIEGFFGFVI
LSLL

Nuc_sug_transp

Nuc_sug_transp
PFAM accession number:PF04142
Interpro abstract (IPR007271):

This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles. SLC35A1 (P78382) transports CMP-sialic acid, SLC35A2 (P78381) transports UDP-galactose and SLC35A3 (Q9Y2D2) transports UDP-GlcNAc [(PUBMED:25210595)].

GO process:pyrimidine nucleotide-sugar transmembrane transport (GO:0090481)
GO component:Golgi membrane (GO:0000139), integral component of membrane (GO:0016021)
GO function:pyrimidine nucleotide-sugar transmembrane transporter activity (GO:0015165)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nuc_sug_transp