The domain within your query sequence starts at position 45 and ends at position 195; the E-value for the Nucleic_acid_bd domain shown below is 2.6e-61.
DSTIFVAFKGNIDDKDFKWKLDAILKNVPNLLHMESSKLKVQKVEPWNSVRVTFNIPREA AERLRILAQSNNQQLRDLGILSVQIEGEGAINLALGQNRSQDVRMNGPVASGNSVRMEAG FPMASGPGLIRMTSPAAVMTPQGGNMSSSMM
Nucleic_acid_bd |
---|
PFAM accession number: | PF13820 |
---|---|
Interpro abstract (IPR032715): | This entry represents a putative nucleic acid-binding region found in nuclear receptor coactivator 6 (NCOA6). NCOA6 is involved in the coactivation of different nuclear receptors, such as steroid receptors (GR and ERs), retinoid receptors (RARs and RXRs), thyroid hormone receptors (TRs), vitamin D3 receptor (VDR) and prostanoid receptors (PPARs) [ (PUBMED:10567404) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nucleic_acid_bd