The domain within your query sequence starts at position 47 and ends at position 190; the E-value for the Nucleic_acid_bd domain shown below is 3.3e-55.

TIFVAFKGNIDDKDFKWKLDAILKNVPNLLHMESSKLKVQKVEPWNSVRVTFNIPREAAE
RLRILAQSNNQQLRDLGILSVQIEGEGAINLALGQNRSQDVRMNGPVASGNSVRMEAGFP
MASGPGLIRMTSPAAVMTPQGGNM

Nucleic_acid_bd

Nucleic_acid_bd
PFAM accession number:PF13820
Interpro abstract (IPR032715):

This entry represents a putative nucleic acid-binding region found in nuclear receptor coactivator 6 (NCOA6). NCOA6 is involved in the coactivation of different nuclear receptors, such as steroid receptors (GR and ERs), retinoid receptors (RARs and RXRs), thyroid hormone receptors (TRs), vitamin D3 receptor (VDR) and prostanoid receptors (PPARs) [(PUBMED:10567404)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nucleic_acid_bd