The domain within your query sequence starts at position 2 and ends at position 72; the E-value for the Nucleolin_bd domain shown below is 1.9e-31.

KPRPGVFVDRKLKQRVIQYLSSNRCGKYVDTGILASDLQRLYSVDYGRRKRNAFRIQVEK
VFSIISSEKEL

Nucleolin_bd

Nucleolin_bd
PFAM accession number:PF16725
Interpro abstract (IPR031996):

This entry represents a domain found at the N terminus of nuclear valosin-containing protein (VCP)-like protein 2 (NVL2). This domain adopts a three helix fold resembling part of a winged helix motif and binds to nucleolin, a multifunctional phosphoprotein ubiquitously distributed in the nucleolus, nucleus and cytoplasm of the cell [(PUBMED:21474449)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nucleolin_bd